PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_2BA3A755A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 729aa    MW: 77177.1 Da    PI: 6.8644
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_2BA3A755A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY97.31e-30299355259
                            --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            +Dgy+WrKYGqK+vk se+prsYY+Ct+++C+vkkkvers+ +++v+ei+Y+g+Hnh+
  Traes_2BL_2BA3A755A.1 299 EDGYSWRKYGQKQVKHSEYPRSYYKCTHPSCQVKKKVERSH-EGHVTEIIYKGTHNHP 355
                            8****************************************.***************8 PP

2WRKY104.75e-33527585159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++d k v++tYeg+Hnhe
  Traes_2BL_2BA3A755A.1 527 LDDGYRWRKYGQKVVKGNPNPRSYYKCTHPGCSVRKHVERASHDLKSVITTYEGKHNHE 585
                            59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.63293357IPR003657WRKY domain
SuperFamilySSF1182904.05E-25293357IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-27293357IPR003657WRKY domain
SMARTSM007743.1E-33298356IPR003657WRKY domain
PfamPF031061.7E-23299355IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.0E-37512587IPR003657WRKY domain
SuperFamilySSF1182907.72E-29519587IPR003657WRKY domain
PROSITE profilePS5081137.539522587IPR003657WRKY domain
SMARTSM007744.0E-38527586IPR003657WRKY domain
PfamPF031063.0E-25528585IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    Send to blast
MDGHTHLAME WKDQSPGADC SMLPSFLTDP FPADPLVEDC DGGNDGSEGA GFERHGLSVA  60
VGSPQEEGKP ATPHFGQRSS SSSSLSERMQ ARAGFSVAKL SMPGSEYSGA QSPYLTIPPG  120
LSPASLLESP VFLSNAMGQS SPTTGKLLML GDTNNNNNAR LEPPSVEDGP RAFSFKPLDL  180
KSSQYTAEGK KASLPNSQHP SAPSRDVPVK TETNIQTTTR GANPLGHLNQ AQFNNGQDLM  240
KRSYHDCNNK RNRLPADSAT AGGDNNAPPP DHGPPATAVD SEAAKGDYPA AVATAAPAED  300
GYSWRKYGQK QVKHSEYPRS YYKCTHPSCQ VKKKVERSHE GHVTEIIYKG THNHPRPAAQ  360
SRRPAGGAQV HPFNDAQMDA PADNNNNGYG NAGGSQPNAE ARSLWHAGVA VQDWRGDGLE  420
ATSSPSVPGE LCDSSASMQV HDGAARFESP EGGVDVTSAV SDEVDGDDRV AHGSMSQGQG  480
AADTTEGDEL ESKRRKLESC AIDMSTASRA VREPRVVIQT TSEVDILDDG YRWRKYGQKV  540
VKGNPNPRSY YKCTHPGCSV RKHVERASHD LKSVITTYEG KHNHEVPAAR NGGHGSSAAS  600
GGTGASQLSH ARRAEPPSVQ DGLMRLGGCG APFGLPPRDP LGPMGNYPWP PPSLPXXXXG  660
AVEGLKLPML SPSLHSVFRQ RQAMETAAGF RVPKGEVKDE AAGAGAGGGA AAAAAYPQMM  720
SRLPLGHRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-36299588878Probable WRKY transcription factor 4
2lex_A2e-36299588878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3767650.0AK376765.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3135C08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751041.10.0PREDICTED: probable WRKY transcription factor 20 isoform X1
TrEMBLW5B8450.0W5B845_WHEAT; Uncharacterized protein
STRINGMLOC_77883.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP207538100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56270.11e-91WRKY DNA-binding protein 2
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]